Its A Family Affair
OVERVIEW
ITSAFAMILYAFFAIRWITHSCRAPPYNANA.BLOGSPOT.COM RANKINGS
Date Range
Date Range
Date Range
LINKS TO WEB SITE
Special Guest Designer Inspiration - Giorgia Rossini. Happy Birthday-hat-Sketch N Scrap challenge. FREE Birthday Digital Colouring Page! Corn on the Cob - Lasting Memories Layout Challenges DT Reveal. Hard To Believe It Is Mid-March. Busy life means digital layouts.
Sunday, February 18, 2018. Busy life means digital layouts. I am not giving up paper scrapping. This was my kick me in the behind to get back at it. I fully believe in inspiring anyone I can.
Wednesday, August 12, 2015. I am actually here today sharing. Both of these layouts were created using the July sketches. There is still time to link up to BOTH the July and August sketches. The more you link up the more you increase your chances of WINNING. My first layout was created using Bella Blvd. My second layout I made using some old pictures that I need to FINALLY scrap. Happy Scrapping my friends,. Monday, August 10, 2015.
WHAT DOES ITSAFAMILYAFFAIRWITHSCRAPPYNANA.BLOGSPOT.COM LOOK LIKE?
ITSAFAMILYAFFAIRWITHSCRAPPYNANA.BLOGSPOT.COM HOST
WEBSITE IMAGE
SERVER OS AND ENCODING
I found that this domain is operating the GSE server.PAGE TITLE
Its A Family AffairDESCRIPTION
Sunday, August 16, 2015. Today I would like to share a layout featuring my Mom. We recently had a family birthday party to celebrate her 87th Birthday! My husband every year for my Moms birthday and Christmas buys my Mom a crown to wear on her special days! Here are some closeups. I used two types of Thickers - Celebrate and Amy Tangerine -Lovely for my title. I machine stitched through them to hold them in place. A little stamping and spritzing to finish things off! Links to this post. Here is my layout.CONTENT
This web page itsafamilyaffairwithscrappynana.blogspot.com states the following, "Sunday, August 16, 2015." We saw that the webpage said " Today I would like to share a layout featuring my Mom." It also said " We recently had a family birthday party to celebrate her 87th Birthday! My husband every year for my Moms birthday and Christmas buys my Mom a crown to wear on her special days! Here are some closeups. I used two types of Thickers - Celebrate and Amy Tangerine -Lovely for my title. I machine stitched through them to hold them in place. A little stamping and spritzing to finish things off! Links to this post."SEEK SIMILAR DOMAINS
Hey i love lil bow wow. Abonne-toi à mon blog! My best vriends 4-ever.
Bonjour a tout je vous laisse visite mon blog a partir de 10com je les lache double. Abonne-toi à mon blog! Toujour en delir mais trop cool cette aprem a la cam avec toi manon trop de delir jtd grave bisou. Retape dans le champ ci-dessous la suite de chiffres et de lettres qui apparaissent dans le cadre ci-contre.
Se blog es banal maiis pour moii il es chere a mes yeux car ils contiien les personne les plus chere a mes yeux et ki son dans mon coeur alors chuutt et regarder bisous a vous. Abonne-toi à mon blog! Retape da.
Rocky , Loustic mes Chouchou ;D. Clique ici pour poster un commentaire en étant identifié avec ton compte Skyrock. Et un lien vers ton blog ainsi que ta photo seront automatiquement ajoutés à ton commentaire.