The Hammerstrom Family
OVERVIEW
HAPPILYMARRIEDTHREEKIDSWHATSNEXT.BLOGSPOT.COM RANKINGS
Date Range
Date Range
Date Range
LINKS TO WEB SITE
Sunday, July 1, 2012. We started off our summer trip with a stop in Logan to visit the Barkers. They boys loved playing in their backyard, spending time with their cousin Vance and of course getting spoiled by Grandma and Grandpa. Riding the lawnmower is always a hit with the boys. G got a lot of fireman practice with the hose. Griffin in the dog house. Ben, Julia, Griffin and Sophie. Sunday, June 24, 2012.
Saturday, March 30, 2013. Old Man Triathlon and Easter Party. Today my dad and father-in-law participated in the American Fork Triathlon. I am so upset because I was too late to see my dad come across the finish line. Man that old man can run fast! It was a good day and once again so proud of my dad and Jeff for their big accomplishment! Wednesday, February 20, 2013.
Tuesday, June 16, 2009.
WHAT DOES HAPPILYMARRIEDTHREEKIDSWHATSNEXT.BLOGSPOT.COM LOOK LIKE?
HAPPILYMARRIEDTHREEKIDSWHATSNEXT.BLOGSPOT.COM HOST
WEBSITE IMAGE
SERVER OS AND ENCODING
I found that this domain is operating the GSE server.PAGE TITLE
The Hammerstrom FamilyDESCRIPTION
What39;s going on in the Hammerstrom FamilyCONTENT
This web page happilymarriedthreekidswhatsnext.blogspot.com states the following, "Whats going on in the Hammerstrom Family." We saw that the webpage said " Sunday, August 14, 2011." It also said " Happy 5th birthday, GAGE! Tuesday, July 19, 2011. I have been absolutely horrible about the whole blog thing, but what can you do. So here is summer so far. The hot husband and I at the dino park. Brett and the kids posing with the dino. Brett getting eaten by a dino. Jett making a mess eating his cookie at grandmas work picnic. Grandma and Khloe playing a game at the picnic. Brett and the kids playing cards before the fireworks."SEEK SIMILAR DOMAINS
Currently bike-less but not for long! Monday, September 26, 2011. From now on all new posts will only be published there! Links to this post. Tuesday, September 06, 2011.
to the cows! Excerpts from life on a small dairy farm. Wednesday, March 21, 2018. I Thought It Was Spring! Just when we were starting to feel a hint of spring in the chilly air, and when the earliest daffodils decided to bloom. My rooster is a little snow-laden. Somebody loves the snow! The warm radiators can do their part in drying the coveralls, hats and gloves.
A Girl, A Guy, And A Movie. By A Girl A Guy And A Movie. By A Girl A Guy And A Movie.
We hunted for rocks this Easter. Link about a family who filled their baskets with rocks before Easter. I loved the symbolism so much that I had to steal her idea and take my family rock hunting. We talked about how much fun w.