DEFYDESIGNSVSMICHAELPARTRIDGE.BLOGSPOT.COM HOST
Our parsers identified that a lone page on defydesignsvsmichaelpartridge.blogspot.com took four hundred and forty-two milliseconds to come up. We could not find a SSL certificate, so our crawlers consider defydesignsvsmichaelpartridge.blogspot.com not secure.
Internet Protocol
173.194.205.132
WEBSITE IMAGE
SERVER OS AND ENCODING
I found that this domain is operating the GSE server.PAGE TITLE
Defy Designs vs Michael PartridgeDESCRIPTION
Wednesday, 20 July 2011. Thinking for Tuesday part 1. Are a bad from Portsmouth and a generally nice bunch of people. When they needed a logo and a website, they came to me! Which is always nice. There is a site, which you can see in the links at the end, but I want to go into more detail about in another post, so this is part one, just the logo. This is one of those jobs that I look at and think to myself, Did I make that? Posted by Michael Partridge. Please dont be offended. Monday, 18 July 2011.CONTENT
This web page defydesignsvsmichaelpartridge.blogspot.com states the following, "Thinking for Tuesday part 1." We saw that the webpage said " Are a bad from Portsmouth and a generally nice bunch of people." It also said " When they needed a logo and a website, they came to me! Which is always nice. There is a site, which you can see in the links at the end, but I want to go into more detail about in another post, so this is part one, just the logo. This is one of those jobs that I look at and think to myself, Did I make that? Posted by Michael Partridge. Monday, 18 July 2011."